SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|154354|fgenesh1_pm.3_#_178 from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|154354|fgenesh1_pm.3_#_178
Domain Number 1 Region: 419-579
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-20
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 66-283
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000502
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 307-385
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000216
Family Rhamnogalacturonase B, RhgB, middle domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|154354|fgenesh1_pm.3_#_178
Sequence length 581
Sequence
MASALTLLGVAAALAAASPLQEKPAGATQQQQQQQQPKSFLKEIGPSTWVLGNELWNVTQ
NAQYANKLMYRGKDRVGNAVGHYVSYNGAASDLTWTSAAIVDSDADWIDVKFTAREGDFH
WVIFDDLPGAYQYFVNRALPTLGEFRTLWRLDNASFTNGHTDVKDGALPRLEEYVDAVKV
QDETWEKPDGTYLTKYDWSAFVRDQTYHGVYGDEVGSWYIRPGKDYNNGDHLKQELMLHR
ESQTGDTVQLNMVHGTHYQATSRDAFGVGKTWGPWLWYLNDGSQSDAAARWTAEQAAWPY
AWFKDAAYQARGTLTGSLLLSDGPPASGAAIFLGDNRNTTVSTLDQGQKYYYTTYADEKG
AFSIPHVRTGSYALSAWSNAGSLSPLTTTFTHNDIAIEAATTTSLPHLTWPVSVSSTTAT
RIFQIGAFDPKTDGFRFADPTSPIQHARLDKCPANLTYTVSVNEASDWCFAQSQLGTWSV
IFASPTRAAATLVLSLAGFSQGSSATVLLNGVRVGDISSAALPNSQDTYRGATRAGEWHR
LEFPVGAGVLVQGSANTLDIRVTKSERWRGWLWDSLVLETA
Download sequence
Identical sequences R0IHQ7
XP_008027271.1.61199 jgi|Settu1|154354|fgenesh1_pm.3_#_178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]