SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|170849|estExt_fgenesh1_pm.C_1_t20339 from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|170849|estExt_fgenesh1_pm.C_1_t20339
Domain Number 1 Region: 215-643,676-752
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 8.85e-192
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000191
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.09e-71
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|170849|estExt_fgenesh1_pm.C_1_t20339
Sequence length 891
Sequence
MFVFKRDGRRERVQFDKITARVSRLCYGLDPDHVDPAAITMKVISGVYQGVNTTQLDDLA
AETAAYMTTTHPDYAILAARIAVSNLHKQTKKQFSAVVADLYNYVNPKNGKHQPMISDSV
YKVIQDHADELNSAIVYDRDFNYQFFGFKTLERSYLLRIDGKVAERPQHMLMRVAVGIHG
EDIEKAIETYDYMSQKYFTHASPTLFNAGTPSPQMSSCFLIDMKEDSIDGIYDTLKTCAL
ISKTAGGIGLNVHRIRATGSYIGGTNGTSNGLIPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHADVFGFLDLRKNHGKEEVRARDLFYALWIPDLFMKRVQENAEWTLMCPNECPGLA
DVYGEEFEALYESYEKQNKGRETVRAQKLWYAILEAQTETGNPFMLYKDACNRKSNQKNL
GTIRSSNLCTEIVEYTAPDEVAVCNLASLALPSFVDYKRGEFDFNKLHEVTQVVTRNLNK
IIEVNHYPVEEARRSNFRHRPIGIGVQGLADAFLALRLPFESQEAKKLNIQIFETIYHAA
LTSSCDIAKELGPYATYEGSPVSQGILQYDMWNVTPTDLWDWTQLKAKIAEHGVRNSLLI
APMPTASTSQILGNNECFEPYTSNIYSRRVLAGEFQVVNPWLLKDLVDMGLWSENMKNRI
IAEGGSIARIPNIPDETKTLYKTVWEISQRTIIQMAADRGAFIDQSQSLNIHMKEPTMGK
ITSMHFAGWKLGLKTGMYYLRTMAASAPIQFTVDQEALKVADTNVARALPKVRKQPGFVP
EAIRSSTTSSQTSVAVSQPKTSENGVPAPAADPESRNALASKPFKADVEEGESPKMVAAD
AISKPDEDLTDKTKQEEDSKDGSEARDGDIYADAVLACSIENPEACVMCSG
Download sequence
Identical sequences R0J5M4
jgi|Settu1|170849|estExt_fgenesh1_pm.C_1_t20339 XP_008021096.1.61199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]