SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|24474|gm1.6600_g from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|24474|gm1.6600_g
Domain Number 1 Region: 129-312
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-36
Family Hypothetical protein AT3g04780/F7O18 27 0.00033
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.06e-20
Family Thioltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|24474|gm1.6600_g
Sequence length 329
Sequence
MSATVEIKSPAQLSSLLSSSRVVVVNFYNEENTSSKAIAPVYDQLAGQLSRPGKVTFSKV
STVQQAQIAQSYNVTNTPTFIIYKNNQQIRKYSGSNPQQLSEAIKTLAAEAENEGNGLDS
ASGSSGSGAWTGASLPRGYTDVTDVVDVRGLDLLNADSDFGTVRTLLETSAPSSLSKGKA
AQGKKDWVESDVDNQLMLFVPFTATIKLHTIHLTSYISPDNAEDDDEAPVRPKTIHVWTN
RQHNLGFEEADDVPATQVIELKPEDWDPTTHTAKLELRFVKFQNVASVVLFVADADGDSE
KTRIDRIRFIGETGEKREMGKLEKIGQDD
Download sequence
Identical sequences R0JXG4
jgi|Settu1|24474|gm1.6600_g XP_008031189.1.61199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]