SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|31049|fgenesh1_pg.2_#_229 from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|31049|fgenesh1_pg.2_#_229
Domain Number 1 Region: 78-175
Classification Level Classification E-value
Superfamily Rubredoxin-like 1.65e-31
Family Cytochrome c oxidase Subunit F 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|31049|fgenesh1_pg.2_#_229
Sequence length 210
Sequence
MFVQRSAIAAARRVAPRAFAQRAFSTSFIRRDANNEAKESNIAQKETGHSANAPSILEGF
KKLEEIKSEADLLAPGAQPGTVPTDAEHATGLERLEILGKMQGIDIFDMRPLDASRVGTM
EDPIVVNSAGDEQYVGCTGCPADSHNVIWITLTREEPKSRCMECGSAYEMHYVGPAEDSH
GHDDHHGHHENPYPRPKNMADFIKPEYAEL
Download sequence
Identical sequences R0KBG2
jgi|Settu1|31049|fgenesh1_pg.2_#_229 XP_008025017.1.61199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]