SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFHG_01581T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFHG_01581T0
Domain Number 1 Region: 308-407
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 2.09e-17
Family Cdc48 domain 2-like 0.002
Further Details:      
 
Domain Number 2 Region: 510-555
Classification Level Classification E-value
Superfamily RING/U-box 7.57e-16
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Weak hits

Sequence:  PFHG_01581T0
Domain Number - Region: 403-433
Classification Level Classification E-value
Superfamily F-box domain 0.085
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFHG_01581T0
Sequence length 557
Comment | PFHG_01581 | Plasmodium falciparum (isolate HB3) conserved hypothetical protein (558 aa)
Sequence
MNSYRSSTSKHINFINNVNLKRRKQVIEKKNILEKVHILPIKKNVYNFTKLYQKLNSLIN
EECILYEGFIININEHDMKEKEHEINNKINNCITNEECVNYKNYNTSNVNNINDDEKETH
DYNIDIEQTNTDNTHDKKETIKTKNRDNHNISNNEKQKPTFEYKNNFHNNTDYIIINCVP
STGILSHDTLIYTDGKYVDNLRKIHILIIKDKNYKKYEKKCQKYFGSIKKYLLKKSNQIF
HEAFSFVSYSLDCFSYKLSTKDGTEKKDSDDQLTNIDSSDDVANINSCAQVDKCNKYDQE
IILSVDTYEQYKNVHIVPMYDTLPTTYNYDLFMDYVKPYIERHYLNVYSIHDTFFYKGVQ
FKIMGIDPVNIKYGKGRISCNTFIYTEGCIKPTFFDVISKESINYIRSLPFEYKPYAILN
ILQHLDSDSLLRLFPSSNINIRENHKKEEKLLEQLTKHKYIFNKNFKNNYTKNSLENNDS
KNKENYHHINRKRELHTTTSTLKSNLINEQCAVCFEYFQDYDKCIKLTCLHTYHWKCVKN
WFKFNLTCPCCRYKLNF
Download sequence
Identical sequences A0A0L7K8R8
PFHG_01581T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]