SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFHG_01878T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFHG_01878T0
Domain Number 1 Region: 472-773
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-52
Family Duffy binding domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 164-441
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-48
Family Duffy binding domain 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFHG_01878T0
Sequence length 1380
Comment | PFHG_01878 | Plasmodium falciparum (isolate HB3) hypothetical protein similar to erythrocyte invasion ligand PEBL/EBA-165 (1381 aa)
Sequence
MIFHYELVNFYRKKQKGLIFKKEALLEDKKNVDNKDIKEQLPENNKNFEEKILHEDICKL
NKENIEKEGLYKPNTFKSIGNDLLYKKGKLNFLYEYGMELLHINKVPMNRMNNSRGLGDS
NMSFLDISNNNMNSLNSMNNLNNSNNFDSSNSLSFVDMKSIHRCIKKRAKGERDWACNDK
NTKEPNICVSDRRVQLCTGNLIELPINDSTKEKFKEKLILAAQKEGSLLFEKFGKKYNEE
FCLNLKWSYGDYGDIIKGTDMEGLGRSIKVEFEIDRIFKRDNEKSAENRKKWWEEISTHI
WNAMIKEHKEKFPKDVKECSADKPLDEPQINRWLMEWAYDTDYNKNLWYNKLDDSKNKCN
RICPKEEICKSECKKYKAWIDKKNNDFTILSEIYLKYNKKSSLYKTAFEYLKQKWDKYKE
LNFSSIFDQLNAKYYNKCICQNNKIENNALYVKIEDICNNTKVKSIYGELYCKEKGNDKI
WQCINEHIKDFPDVCGPPRRQQLCLGNLDKDEFKNVNDLKKFLNEIILGIRDEGKFLIEK
YRKNMHENMYLDERACKYLNYSFDDYKNIILGKDMWRDPNSIKTENILKGNFEGIKANIV
SMYPSYADLSLDEFRKHWWDQNKKQLWEAISCEFYKGNHTGVCLMEDDNDNQYLHWFREW
KNDFCIDKLKWNDVIKEPCIDKKVKSPKPSENPSDVATVCNKSCTDYDKWIINKRKEYKM
QSSKYKRDRSLFNNVIQNLKPWEYLSMKCTECTCNLDTQTFVYPYKGYEDICKSTVKPYD
PEDIKDEEFNEPSLNVNPLSLTSQDVTERVSSVDDVLSIKENVDLKPFKPKGGTQSSHVD
QVGNTRESESKPSGANGREDPSTESSTYNDGVITSSSSLGSSSGRDVSSSPVGVGDEHEA
KELLPPQKIIDGVTQSDESTLSQHGKESSQEQHNLDGSSLSRHSNQDEEGSIITSDVAHG
TNSLFGGQIQDQETILGESEPLTTSPPEHETSKMDTHAGGKNMEQVRNASVDSSSEMSSG
GRGGLKTKEMKGEEVTGITSKNDINLEDSTVHSRQNKIENSGDNTQGKEHINVLQGMDKH
LENPPTSERGDSVLESEFSKLNRTSHTHDNNRIETTAENNIGGLSNSNVHDGRDSQRNRM
HINSRSRHGSLESDIVVRGDDISNIEGEGEEEEDANTLKYPRNVLNNKNSRTYNIEEYIY
RDVNKVADDIMRSYKSNRCTNNLSSNYCSKLKKESLSNSCTNEDSKHLCCSISDYCMKFF
NFNSSGYHSCMRKEFSNPAYKCFAGKGFSNMYYFAGGGLFFIILFLLGAKSSILNWSEDN
ELNGTAFEEANFEDAAFEVTTGQDSAFEDYDENAYRIGLLMNQKIQSAKSSDYLEYHVDN
Download sequence
Identical sequences A0A0L7KAJ8
PFHG_01878T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]