SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFHG_03051T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFHG_03051T0
Domain Number 1 Region: 15-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.57e-33
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFHG_03051T0
Sequence length 208
Comment | PFHG_03051 | Plasmodium falciparum (isolate HB3) hypothetical protein similar to transmembrane protein 17 (209 aa)
Sequence
MAIFKKSIIIFLFFTFFNYCFSQDVIELNDSNFESLTQLSTGNTTGSWFIKFYAPWCSHC
KAMSKTWAQLATELKGKINVAKIDVTLNSKTRKRFKIEGFPTLLYFKNGKMYDYKNHDRS
LEAFKNFVLETYKNAKASEPPKPLNYMDILKDFLNETFQNIDRIYKYAFPSLAVLVSVSF
LTGSIFSLILLKCCCMKSGASKVAKKKD
Download sequence
Identical sequences A0A024WL80 A0A024X3B0 A0A060RY51 A0A0L1IG45 A0A0L7KD91 Q8IDH5 W4ICC7 W7F8Q7 W7FP48 W7JNJ8
PF13_0272 gi|124513762|ref|XP_001350237.1| gi|23615654|emb|CAD52646.1| PFHG_03051T0 5833.PF13_0272-1 XP_001350237.1.26446 XP_012764892.1.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]