SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFHG_03972T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PFHG_03972T0
Domain Number - Region: 30-96
Classification Level Classification E-value
Superfamily RING/U-box 0.0459
Family Variant RING domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFHG_03972T0
Sequence length 205
Comment | PFHG_03972 | Plasmodium falciparum (isolate HB3) conserved hypothetical protein (206 aa)
Sequence
MGSTDYRVLNDGDEKSLKVYFQRKNNSDEQAELFCFICLEKNFENSNLISCCSLCTACVH
KKCWYTWRRNQKLSALRSKILGLNKLNPLLCTICKTGIAKIEEENDMNWIINNNSNKEYL
QDELLRIISSLLNNEINDNHMPMLHIKYIFSFNFIFLILSIFLIILFSVVFNFTLTYVLL
IALFILYEIIVLQIVLYLYIRIKYN
Download sequence
Identical sequences A0A024V4B9 A0A024VNA1 A0A024W3Z3 A0A024WMT3 A0A024X3W8 A0A0L7KGQ3 Q8I530 W4IEK0 W4J3A5 W7F4K8 W7FRN4 W7J953 W7JQP6
XP_001350787.1.26446 gi|124806663|ref|XP_001350787.1| gi|23496915|gb|AAN36467.1| PFL1905w 5833.PFL1905w-1 PFHG_03972T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]