SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFHG_04274T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFHG_04274T0
Domain Number 1 Region: 35-203
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.42e-30
Family Duffy binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFHG_04274T0
Sequence length 569
Comment | PFHG_04274 | Plasmodium falciparum (isolate HB3) conserved hypothetical protein (570 aa)
Sequence
MEEISNNEDNEKETFNRIIEKVKIPAELEDVIYRLKHHKYNSNDYICNKYKNINVNMKKN
NDNIWTDLLVKNSSDINKGVLIPPRRKNLFLNIEKSDICKYKKNPKLFNDFIYSSAISEV
ERLKKVYGEARAKVANAMKYSFADIGNIIKGDDMMKSPTSKYIEQIFKGTEYSGIDSETW
WDMNKYHIWESMLCGYKQAGGDTQTERKLQKKPKSPVDLLRVLDIHKGDYGIPTPKSSNR
YIPYVSDTYKGKTYIYMEGDTSGDDDKYAFMSDTTDITSSESEYEEMEINDIYVPGSPKY
KTLIEVVLEPSKRDIQSDDIPNNDTPTNKFTDNEWNQLKKDFISNMLQNTQNTEPNILRD
NVDNNTHPTMSRDNMEEKPFITSIHDRNLYSGEEYNYNINMVNNDDIPINRDNNVYSGID
LINDSLSGGEPIDIYDEVLKRKENELFGTNHVKQTSIHSVAKLTNSDPIHNQLELFHKWL
DRHRDIHDDILKIKDETYNIISTNNLYSYENNDITPHQLGLPNIIPSGIIKHQNNGLRTN
ISMDIPFDEQNNNLENSNITYEDDEVQNS
Download sequence
Identical sequences A0A0L7KI59
PFHG_04274T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]