SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFHG_04358T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFHG_04358T0
Domain Number 1 Region: 107-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-26
Family UAS domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFHG_04358T0
Sequence length 392
Comment | PFHG_04358 | Plasmodium falciparum (isolate HB3) conserved hypothetical protein (393 aa)
Sequence
MCNGNVEDSLKLYYDINGDNMIPNKPYDNNNKIMTEEEKSVQSNMYQTNTETTNDKKKNI
CPPCDDYVRAPDKHFSQALINDMDDSNFYPYNNTNKKSNKSKIQLGDTFQKLFSPPESLI
CSLSFEEVRKKSKQENKFILVNIQNTEFESLRLNRDIWNNDVIQQIIKTSFILWLRYEYD
QDAALFMNTYKVHKLPYLCVLCKRTGRQLKVWNIRNFQDPICAQSQLYEFIEMMEIKSNS
RNIKDITTSSKNISTNILDTTTTTTTTTTTTTNININNNNNYGDRDDHGDDHMLHNINNK
NIDTLKEPYRNIPPSGYDKNKLLYPETTHQILQEEKKDSIHNFNNNSYNNPNLKETESED
KKTPDVVEEYNTINNELSQLHKLRMQRFQKKN
Download sequence
Identical sequences A0A0L7KGX2 Q8IIC1
PFHG_04358T0 5833.PF11_0253-1 gi|124804174|ref|XP_001347924.1| gi|23496177|gb|AAN35837.1| PF11_0253 XP_001347924.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]