SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFHG_05243T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PFHG_05243T0
Domain Number - Region: 25-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000273
Family Thioltransferase 0.051
Further Details:      
 
Domain Number - Region: 135-161
Classification Level Classification E-value
Superfamily RING/U-box 0.0362
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFHG_05243T0
Sequence length 185
Comment | PFHG_05243 | Plasmodium falciparum (isolate HB3) conserved hypothetical protein (186 aa)
Sequence
METENVPLENEENQNENYEQEENTLAQEAEIVLITTSLGGIKSSFFSSLRAHQLLNCKKY
IYFSIDANRDTSSAKNLKDIELFNKWKKGMILLSNENGIVLPQILIDGVPLGNDVTLQNL
EDEGILDYIIARLKCPNCLIDKSNIEERCPGCKKYYVTLITDDLIQNDSVIRILQGEPYK
EPENE
Download sequence
Identical sequences A0A024V7P6 A0A024VQK7 A0A024WRU4 A0A024XBC0 A0A0L7KK50 A0A2I0BWV8 Q8IBC0 W7ESK1 W7G0G6
5833.PF08_0007-1 PF08_0007 XP_001349237.1.26446 gi|124512208|ref|XP_001349237.1| gi|23499006|emb|CAD51086.1| PFHG_05243T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]