SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|109911|e_gw1.1.3816.1 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|109911|e_gw1.1.3816.1
Domain Number 1 Region: 656-783
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.48e-32
Family Single strand DNA-binding domain, SSB 0.00011
Further Details:      
 
Domain Number 2 Region: 785-812,959-1038
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.68e-17
Family Single strand DNA-binding domain, SSB 0.017
Further Details:      
 
Domain Number 3 Region: 510-651
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.00000000000000471
Family BRCA2 helical domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|109911|e_gw1.1.3816.1
Sequence length 1041
Sequence
MDGIDGLGGEGSGNGQGARIHATGGAIFSQKCVDWSSSPLINPSGSQERAADDDFFSAGT
GADASVASGSSINAAGQPPLPINGSGFASAATLHGRTAPPRPFTGFSSAAKLPARPQSRP
IHQPDERTTATPSAPSKFAGFGLASALPLQAADDQPPSPPPQQDYDSWFDSEASALPPDA
VGFKTARAILDTSEDAVEPPASQISQFGGFTSGLAKWKPASQASENEDTEADLARANVSS
GFTSAALVDPAAAPMVSFSTAAHILVGKTNWAAPSAEALARAAQKMKQWEAEIDLEEQPS
GAANTENNAPPNSHPPASRPPSLETPLRPVLRPMENGFSVMQPPDTPSPAGAAPKNPPHF
TVVAGMTIKNTPFKSPLMAKHQAQPRSVSAPSLYTGSPLNPERSTGFRAAPFVSPAKPGT
MPFASPMKASTSSLASPVKALGMTPRRLGFSSTAGKGKFASPFKPGLAPGDPGRSQLDLK
LKEEQARANSAAPVQIQVVGAPSSKGKERKDCQFFDLNPVPERQTLASSGLQPLSYTEDD
LEDMGINVEELRQMRPSNAVFYRFNSAVATVGIEDPAESEQLGPKAAFVHLKERGCDLVT
QEWVTTQYGLILWKLAGLVCLEPEREQNVKTKRWCWPEVIRQLLYRYERELVGGSRPALR
LVSTEDAPAACPMILCVSNIVILGTSPRAKNGTAYEPHPELEVTDGWYRLRANVDLPLAR
AIRRGRICIGSKLAISGAKLSGGRKEPCEILDAYDNTMLELTGNCTNLAPWHAKLGFVKQ
PFIATLDKLTPDGGNVPAMDLIITKTYPIAFLEFIKHEDGSTSKIGPRDEKEEMKAHDQW
LAKQEMESSKIRERLEADVQHLLKLAERLYSRAGPHFDLSFSRGDPMPDYIEGLYEKMME
QYLKPSQAWDRMDAFTAGWLHVYCKQQADLAMARLQDDLEKEMRDICPPRNVRDFRVVVA
KDARWHKKEAMRSVQITVWDPLKVVFTENGSPGEIKEGQRFLVTNLMPNQGNAWMTPAPG
AEVYLVAKRTSRWTNIKSAKC
Download sequence
Identical sequences XP_008032716.1.43472 jgi|Trave1|109911|e_gw1.1.3816.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]