SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|138819|estExt_Genewise1.C_1_t30247 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|138819|estExt_Genewise1.C_1_t30247
Domain Number 1 Region: 1262-1478
Classification Level Classification E-value
Superfamily TPR-like 1.69e-33
Family HAT/Suf repeat 0.02
Further Details:      
 
Domain Number 2 Region: 974-1074
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.21e-19
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 
Domain Number 3 Region: 880-968
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.09e-18
Family Cold shock DNA-binding domain-like 0.0062
Further Details:      
 
Domain Number 4 Region: 517-606
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.46e-17
Family Cold shock DNA-binding domain-like 0.0045
Further Details:      
 
Domain Number 5 Region: 788-876
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000298
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 
Domain Number 6 Region: 610-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000298
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 
Domain Number 7 Region: 233-325
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000405
Family Cold shock DNA-binding domain-like 0.0026
Further Details:      
 
Domain Number 8 Region: 434-519
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000127
Family Cold shock DNA-binding domain-like 0.0093
Further Details:      
 
Domain Number 9 Region: 117-210
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000112
Family Cold shock DNA-binding domain-like 0.058
Further Details:      
 
Domain Number 10 Region: 330-397
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000305
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 
Domain Number 11 Region: 692-784
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000172
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|138819|estExt_Genewise1.C_1_t30247
Sequence length 1486
Sequence
MAAGKKRVLDETSGSPKAKKTKTEKTAKKAREDAPKPAPTHSTLVADDIDFPRGGGTSLT
PLEVKTLRAEAAKEADSELFAESAKEATTKRRRKSEAGTKSKTTDKDGKKNVIRIEHLNY
KRVAVGMKILGQVVSVEPLALIVSLPNQLFAHVPITQISSQLTHILESEDDAENSDDEEE
EASASRVPDLFEIFQPGQYVRAVVSAVHQPGSTDATGLGRARDEVQKASRRVELSLVPEK
VNEGVAKADLLAGFALSASVKSVEDHGYILDLGIPEVSGFLSFKAAAQKGPSGAEKKFHV
GRLLDVIVTKLSDNGRTCNVSVDSYAPKTAPLTEVTSVKSVVPGALVQSLVTAVQPDGLI
LQVLGFFDGTVDQFHLRSGDTEDNYKIGQKVKARVLYDISPSTPPRFALSLADHVVKYSA
KSAASGSAATDLREAYPVGTTLDAVKVTRIESERGLTVEVGSGVAGFVHISQVSDEHVPT
LSTTSGAWKVGTVHRARVTGYFPLDGLLQLSLKPSILAQKFLQVADVQVGELIKGTVKKL
TDTALFVSISGNVDGVIWPNHYADIVLKHPQKRFKPGGSIKCRVLVVDSERKRIALTAKK
TLVESTLPIVSQLSDVRVGVVTHAVIFKISEKSLQVEFYNNLKASVPAREASETTLSSLS
AAFAIGKPVQVRLIAVDAETGRITASIRQAAPNFKSAITDISGVDIGDIVEGVVSDIRKD
KAVVTLQPTQVTALLSLNNLANRREVSVAQLRSALKVGEKLQDLVVTSRNPEKGFVLVAS
KPKEKEAILQKNHLSLDTVQAGQLVGGRVLRHNRYGALIKLTNSIMGVLHPTDAVDDYES
GKPFPGVDSVLKAVVLSVDKERRQLMLSTRMSRLFPSQDKPIVDREITSLSQLKVGDKVR
GFIKSIAEHGLFVTLGRDIDARVQIKELFDDFVKDWKSRFTVNQLVNGRILSVNVEKKQL
ELSFRSGDLKRDGQSQLSLSDLSEGQKIDGRVKKVEDYGLFIEIEGSKLSGLCHKSELSD
NKDGDVTLALRSFRVGDKVKAVILSVDLEKRRVSFGLKPSYFEEKDFEQESEAEEEVEPA
AALGVVVEDAEMSDNDNEDEDEDEEEDEEVAEAEGPEDDESADDEDEDGGDAAMDVDLTL
DLQRPSGSSAAASSSAPSAALNLADGFQWTVPNPEDDVEMESDDESDSGNEQEGKKKKRK
RKEIEQDLTADMHTKVPESNADFERLLLGSPNSSYLWIQYMSFQLQISEIDKAREIAKRG
LKTINFREEQEKLNVWIALLNLENIYGTDESLEAAFKDAARHNDSKTVHLRMAEIFEQSD
KSEKAEEQFKKTAKKFSQSSKVWTLYAEHYLKRGMLEEARKLLPRSLQSLEKRKHLKTIC
KFAQLEYKLGDPERGKTIFEGIVDSHSKRWDMWSIYLDMEAVQGDIMSLRNLFNRLLTLK
MTSHKAKSFFKKWLELERRLGDEEGQAAVKAKAIEWTQRAAGDAQS
Download sequence
Identical sequences XP_008032782.1.43472 jgi|Trave1|138819|estExt_Genewise1.C_1_t30247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]