SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|140313|estExt_Genewise1.C_1_t70294 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|140313|estExt_Genewise1.C_1_t70294
Domain Number 1 Region: 32-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.35e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|140313|estExt_Genewise1.C_1_t70294
Sequence length 148
Sequence
MASKIGPALKPFLRAQQTSFPSNGHGAFVPQARKLVFEFCDNWASSTNLRTYIHHRLEDL
ARQNPHVEFVVRRRSHREPVIRGFYINNRDKVIGLKGFEVNGIEQKVQILLDSSGAKIKP
LKRDAVVSRTEAARGIWSGLHVEEPFRI
Download sequence
Identical sequences jgi|Trave1|140313|estExt_Genewise1.C_1_t70294 XP_008033212.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]