SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|143925|estExt_Genewise1.C_3_t40213 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|143925|estExt_Genewise1.C_3_t40213
Domain Number 1 Region: 3-211
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-70
Family Glutathione peroxidase-like 0.000000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|143925|estExt_Genewise1.C_3_t40213
Sequence length 217
Sequence
MGLRLGDTAPDFEAETTKGAIKFHEWIGDSWAILFSHPGDFTPVCTTELAEVARRAPDFA
KRNVKLIGISANGLADHNKWIEDINEYGSTDVQYPIIADADRKISTVYDMLDAQDATNRD
AKGLPFTIRTVFIIDPKKVIRLTLSYPASTGRNFDEILRVVDSLQIGDKYRVTTPVNWKK
GDDVIVHPTVSNEEAKTLFPEFKIHKPYLRTTPLKVD
Download sequence
Identical sequences jgi|Trave1|143925|estExt_Genewise1.C_3_t40213 XP_008035640.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]