SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|148196|estExt_Genewise1.C_6_t10119 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|148196|estExt_Genewise1.C_6_t10119
Domain Number 1 Region: 19-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000196
Family Glutathione S-transferase (GST), N-terminal domain 0.0066
Further Details:      
 
Domain Number 2 Region: 166-237
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000625
Family Glutathione S-transferase (GST), C-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|148196|estExt_Genewise1.C_6_t10119
Sequence length 261
Sequence
MTEPIVFYDLPGKDDAHKAVSSNTWKTRFALNIKGIPYKTVWVEHPDIPALSRKIGAPPT
GHNADGSPQYTLPAISDPNTKTVLADSALIVRYLDKTYPDTARLIPAGTDALHAAFDHAF
HSVLDGDLRPLVVNESANALLPRGAAHFRATREAFFGGPLQEIAPPGSEKRAKHWAGVKK
AFGTFAQWFQADGADKPFLLGDSIGYADVTLAAVLVFMQIVLGEDGKEWADLKTWDEGRW
TRYVDAFKKYEGVDVGEMVVL
Download sequence
Identical sequences XP_008038524.1.43472 jgi|Trave1|148196|estExt_Genewise1.C_6_t10119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]