SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|157166|estExt_Genewise1.C_170104 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|157166|estExt_Genewise1.C_170104
Domain Number 1 Region: 5-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000131
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 88-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000654
Family Glutathione S-transferase (GST), C-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|157166|estExt_Genewise1.C_170104
Sequence length 236
Sequence
MPERITLYTAKICPFAQRAEIALAEAKAEFTPFQIDLSNKPEWYAPKVNPASKVPAIAYG
GPEVPPDQPSPESVKLAESLVLVEFVADLFPNSGILSSDPVTRAQTRFFIEGVSSKLIPA
WYAYFLRGASVDDLYTAAEYVQSLLPAEGFAVGKFSAADIAIAPFLARARVSLVNEIGKY
PEGDGKKVWAALTSGKFARLGKYAEDLFARESFSSTFDEDYVTKAFSARFADLRSK
Download sequence
Identical sequences R7S6N2
XP_008045485.1.43472 jgi|Trave1|157166|estExt_Genewise1.C_170104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]