SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|166939|estExt_Genewise1Plus.C_5_t30055 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|166939|estExt_Genewise1Plus.C_5_t30055
Domain Number 1 Region: 49-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.83e-45
Family Cold shock DNA-binding domain-like 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|166939|estExt_Genewise1Plus.C_5_t30055
Sequence length 171
Sequence
MFSAFRLTAQLTRPWATSSVLQRAAAPSLARPALALSRAFHPSLPASATLNQATRRKAPK
KIKASKSPLLEGNTQKKGVVSQIFIAKPKKPNSAKRKVAKVKLTTGKTVQAYIPGEGHNL
QDHSVVLIRGGRTQDLPGVRYKVVRGTLDFSGVVGRVISRSKYGAKRPKQA
Download sequence
Identical sequences jgi|Trave1|166939|estExt_Genewise1Plus.C_5_t30055 XP_008037833.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]