SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|174295|estExt_Genewise1Plus.C_12_t20209 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|174295|estExt_Genewise1Plus.C_12_t20209
Domain Number 1 Region: 179-430
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-60
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00072
Further Details:      
 
Domain Number 2 Region: 510-828
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-42
Family Extended AAA-ATPase domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|174295|estExt_Genewise1Plus.C_12_t20209
Sequence length 922
Sequence
MGLSTPRRQTPLFAPGTSSPLPFPSSSPNKNGTPSRVRRLNYDIPGSQDSEPLAFPSSPA
ASATPKNRRGDIHSSVSITPSSAIPRPRRQNNLPHDDLRSDASHMSIPASSAPNLSAPAV
PSDDEPDEIRAIWGTTVNLGETMKTFREFLRGFKIKYRIAHDRERGLRTRVLSSPEEGEL
LLYEGYLRRMRQTGETNLNLDLVNLAAYPPSKKLQNQLVKYPQEVIPAMDQVLKDLMLEI
AEEDQQAGAEGMRGDEGEEEIAEIMGKVYKIRPFGIPSVNMRDLNPSDTDKLVCIKGLVI
RATPVIPDMKVAFFRCLTCNHTVQVEIDRGKIDEPSRCPRDVCGSLGTMSLVHNRCEFAD
RQVIRLQETPDAVPDGQTPHTVSLSVYDELVDVSKPGDRLIVTGIFRSVPVRVNPRQRML
KSLFRTFIDVVHIRLGSGDKLGLDRSTRPAGGDRIPGVGGVGGGIDMDDDEEHGTERQRR
TSKREELEARLREISRRPDVYEYLARSLAPSIYAMEDVKKGILLQLFGGTNKSIARGGGG
GGPRYRGDINVLLVGDPGTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDPDSKQ
LVLESGALVLSDGGVCCIDEFDKMSDATRSVLHEVMEQQTVSIAKAGIITTLNARTSILA
AANPIGSKYNPEETVTRNIDLPPTLISRFDLLYLVLDHVDEALDRKLAQHLVALYLEDAP
ETGGGQDILPLEELSAYITYARSRMNPTITEAAGDELVRCYVTLRKAGEDPRSSERRITA
TTRQLESMIRLSEAHARMRFSPQVELADVQEAFRLMREALNTSARDPTTGEIDMGLLDTG
IGRQQRKLRADLRRAVLGMLDGAGGGTRGVRWADALAQLEAQSSVRVSTADFGEVIRELE
QEGLVKVVGERDRRMIKRVEGA
Download sequence
Identical sequences jgi|Trave1|174295|estExt_Genewise1Plus.C_12_t20209 XP_008043799.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]