SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|18421|fgenesh1_pg.3_#_480 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|18421|fgenesh1_pg.3_#_480
Domain Number 1 Region: 127-352,488-647
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.77e-64
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000203
Further Details:      
 
Domain Number 2 Region: 11-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-18
Family Anticodon-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|18421|fgenesh1_pg.3_#_480
Sequence length 653
Sequence
MNFNEQVNTAPFEKRTHTCGSLSFKDVDSKAVLMGWLVPKGKVSKKLSFFDIRDSHGTTQ
LVVDSRSCGVDVLSEMRNVPEESTVLVEGSVRRRPTAQQRDVPAGGVEVIVTSFKLLNPA
DRNMPFMPFDTQNLANEDLRLRYRYLDLRRAELTSNLKKRSDVAFLVRSTLHDQGWLIVY
ACPGKGTDVVPGFTEVETPMLLNSTPEGAREYLVPTRVKQSSSDASPQPQFYALSQSPQQ
PKQLLIASGAVDRYFQLARCFRDEDGRKDRQPEFTQVDLEMAWVSWGKQIGEGLSTDADP
WRIGGPEVRDVVESIIRKIWKKVENVELEDRFRVMTYAEAMAKYGSDKPDLRFGLEIQDI
TSQLPEPLRSALQARGEIIEALVVSPHLSHASFARAAEDVEYDKVVERLQLGPSASSAWL
NQSRVAQDVLGPAQSTFDVSELNAALGLTEGGTIWLAKRPQRGEGGWTPLGRLRLALSET
AQRNGDLVLSDDPKFLWVTEFPLFTRADEDKDFLAHGRWSSSHHPFTAPMWEDIEKMYAG
QVEEVRGQHYDLVLNGVEIGGGSVRVHDAAMQDYIFTNILQLDEKEKASFNHLLHALRCG
FDRLMAILCKTTSIRDVIAFPKTAAGSDLLFKSPSPSTAEVLAQYALRPLGRD
Download sequence
Identical sequences jgi|Trave1|18421|fgenesh1_pg.3_#_480 XP_008034739.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]