SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|19094|fgenesh1_pg.4_#_294 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|19094|fgenesh1_pg.4_#_294
Domain Number 1 Region: 102-200,230-502
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.4e-78
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 29-111
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000429
Family Anticodon-binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|19094|fgenesh1_pg.4_#_294
Sequence length 504
Sequence
MLARRFLSSAASLPPTIRQLLSHPPAPSAEAIHVNGWVKSIRKQKQLVFAVISDGSSEAG
LQAVFKDVTLAKRLTNGASVRVSGTLTDSRGAGQAKELLVSDVEVIGECDPKTYPMQKQA
LTVEYLRDHCHLRARTNEIGAMLRLRDTTTRVLNDYFQVGQHFSFMSRAYSCSQNNGFVH
IHTPIITSNDCEGAGETFRIVASSDSPSLSSSTTTQIAPAPPTTDASPSEYFNHPAYLTV
SSQLHLEAVASAISRVYTLSPCFRAERSQTSRHLAEFWMLEAEWAFTSSVEDICAGVEGA
LRAVLRAHLDSPDMAALHRGKPHDRRPELAALADAPQPWTRMTYTEAIAALEAHHATRAF
TFAPAWGRALQSEHERWLADELVRGPVFVTDYPAELKPFYMRANDDAVGAQGPTVACFDL
LIPGLGELVGGSLREERLKLLEAAIERHGLDKADYAWYMDLRKYGGAPHGGFGMGFERLI
SWISGIESVRECVAMPRWAGRMLL
Download sequence
Identical sequences XP_008035994.1.43472 jgi|Trave1|19094|fgenesh1_pg.4_#_294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]