SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|22196|fgenesh1_pg.9_#_219 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|22196|fgenesh1_pg.9_#_219
Domain Number 1 Region: 76-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.43e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 6-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.68e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|22196|fgenesh1_pg.9_#_219
Sequence length 227
Sequence
MASIGTLYTLPTQGSGQRIRAVAALNGLQVDLPEGYVHHQDNDKPEFRAKFPHGKIPALD
GADGFKLFESTAIARYIAGLAPNSTLLGSDLKESALVDQWVSFADSEIAANTTFIYQLVK
GAFGTYVKPIHNTFIERQIRALKTLEAHLSTRTFLVGERITLADISVASVIKRAAMVDLD
ASLRAKFPNVMRHCETVVNQPKLKDIFGPMQSIDKALTYVPPPKEKK
Download sequence
Identical sequences XP_008040874.1.43472 jgi|Trave1|22196|fgenesh1_pg.9_#_219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]