SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|25315|fgenesh1_kg.1_#_136_#_isotig08869 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|25315|fgenesh1_kg.1_#_136_#_isotig08869
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-30
Family Thioltransferase 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|25315|fgenesh1_kg.1_#_136_#_isotig08869
Sequence length 165
Sequence
MSITHLDNTAQLDGILGKSKDKLSVIDFHATWCGPCHMIAPTFEALAKQYPNANFLKCDV
DQAKDIAGRYRITAMPTFIFLKGTSEVERVRGANKPALEAAVRRHSSGSSSGTFSGKGHT
LGDGSSNPGPGPVGGGGVAAFQALDPQVKVLLYLLGGYLVFWWLK
Download sequence
Identical sequences XP_008031793.1.43472 jgi|Trave1|25315|fgenesh1_kg.1_#_136_#_isotig08869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]