SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|25660|fgenesh1_kg.1_#_481_#_isotig04619 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|25660|fgenesh1_kg.1_#_481_#_isotig04619
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-57
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00078
Further Details:      
 
Domain Number 2 Region: 270-471,530-642
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-39
Family Extended AAA-ATPase domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|25660|fgenesh1_kg.1_#_481_#_isotig04619
Sequence length 796
Sequence
MLRQDQRRLIINLDDLRDYRRDFADGLLKQPVDYLPALEDALSKVVERVHDREKHEIEGK
TYRVGFSGSFGDHHVSPRHLRATHLSKMISLEGIVTRCSLVRPKMLKSVHYCPDTGMFHA
REYRDATTSTSNLPPTSSVTPQTDDEGHPLQMEYGYCEFRDNQRISIQEMPERAPAGQLP
RSTDVILDGDLVDKCKPGDRIQLVGVYRSVGGGANGAFKSLILANNINLLSSKVGGGIAQ
TPLTDFDIRSINQLSKRSDIFRLLSQSLAPSIYGHDKIKEAILLLLLGGAEKNLPNGTHI
RGDINILMVGDPSTAKSQMLRFVLGTAPLAIATTGRGSSGVGLTAAVTSDKDTGERRLEA
GAMVLADRGVVCIDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVVAAANPI
YGQYDVHKDPHKNIALPDSLLSRFDLLFVVTDDVDENRDRAIADHVLRMHRYLPPGVEEG
TPVVDSLSQQLSVDGPNVAGEDADEGEPSPFEKYDPLLHVGIGGPSSSTRRGKQKKHEVL
SIAFVKKYIQYAKSKPAPILTKGAADHIVNVYATLRNEDLDGTRKKRTSPLTARTLETLI
RLATAHAKSRLSTKVQRQDAKIAEEILRFALFKEVLRRTRRKKRKLNNGAVDAVDEDEED
GEEGESDEESDEEEAPKRMETPKPKAKAVEKPSPGAQWDGDNDVQMEDEANAAMNAAADE
RGIRPERLKLFKTRLASLFSTKLVDEDQMYLHTLVEMINEGLPTNELFGTAEATAACTIM
TDANEVMLSDGIVYKI
Download sequence
Identical sequences XP_008031841.1.43472 jgi|Trave1|25660|fgenesh1_kg.1_#_481_#_isotig04619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]