SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|29992|fgenesh1_kg.8_#_96_#_isotig03561 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|29992|fgenesh1_kg.8_#_96_#_isotig03561
Domain Number 1 Region: 129-217
Classification Level Classification E-value
Superfamily eEF-1beta-like 1.14e-32
Family eEF-1beta-like 0.0000271
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000113
Family Glutathione S-transferase (GST), C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|29992|fgenesh1_kg.8_#_96_#_isotig03561
Sequence length 217
Sequence
MSANLSKLEAHLATRSYVEGYTPSQADVAVFKAIASAPDASANPHVSRWYNHIKSYTAEF
DSLPGSSKAGEAFLGADAAPAAAAKAEEDDDEVDLFGSDDEEDDAEAERVKAERIAAYNV
KKAGKPKTIAKSVVTFEVKPWDDETDMEALEKCVRSIEKPGLVWGASKLVPIGYGIRKLQ
ITLVVEDELVSLDELQEQVAEFEDYVQSSDVVAMQKL
Download sequence
Identical sequences XP_008040069.1.43472 jgi|Trave1|29992|fgenesh1_kg.8_#_96_#_isotig03561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]