SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|32361|fgenesh1_kg.17_#_14_#_isotig08987 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|32361|fgenesh1_kg.17_#_14_#_isotig08987
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.81e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0076
Further Details:      
 
Domain Number 2 Region: 92-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000156
Family Glutathione S-transferase (GST), C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|32361|fgenesh1_kg.17_#_14_#_isotig08987
Sequence length 252
Sequence
MVQTKRITLYASVDSPFPHRVRLALEEAKAKYDIIWIDLIAKPEWFEKKVNKAGGKVPTL
IYGGGELHEDEEPSPDAATLVESLVILEFLADTFPEAHLLPADPLLRARARTFYMFIETK
LIVAFLGFIFATVSADDMLALLETIQGMLPPTGYVVGEWSIADAAFSPILLRWVHSLENG
LAMFTPETVKQSRDAFNSPRFDRLRKYLEDNVARPSMSKTYDREALEKTMVRRLERFRKT
GVITSELKMPLP
Download sequence
Identical sequences R7S6M3
XP_008045438.1.43472 jgi|Trave1|32361|fgenesh1_kg.17_#_14_#_isotig08987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]