SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|32840|fgenesh1_pm.1_#_184 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|32840|fgenesh1_pm.1_#_184
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000467
Family Txnl5-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|32840|fgenesh1_pm.1_#_184
Sequence length 114
Sequence
MPLQESTDPAAPSWAHTVTADFLIFYSSRDGNGRLWCPDCVSVENLVQNTFGPAEGPSGA
IVYVGQRPDWKTPSNAFRAGPWNVSSIPTVIRTRDGARLVEGEITERLSSFVSE
Download sequence
Identical sequences jgi|Trave1|32840|fgenesh1_pm.1_#_184 XP_008031941.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]