SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|34389|fgenesh1_pm.2_#_475 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|34389|fgenesh1_pm.2_#_475
Domain Number 1 Region: 6-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.33e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 91-233
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000972
Family Glutathione S-transferase (GST), C-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|34389|fgenesh1_pm.2_#_475
Sequence length 244
Sequence
MPCTQQITLYTATFSAYAHRAEIALEEAGAQYTLYKIDLYIRDMPEWYTRVNPLRKVPAI
TFGGPQVPPDEPSPGSQKLRESLALIEFVADTFPESKLLPADPFLRARARTFISLYHSYI
HEQFMNVFFRGVPVTDGFFQAFETLQSALPPTGFAVGEWSLAETAVGPFLARIMLYLDAG
FGWYSEADRETMRAEFASARFARLQQYIQDIRARPSFAKTWGGDAVQVETVRATLPKLRR
ERIA
Download sequence
Identical sequences jgi|Trave1|34389|fgenesh1_pm.2_#_475 XP_008033666.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]