SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|38891|fgenesh1_pm.9_#_189 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|38891|fgenesh1_pm.9_#_189
Domain Number 1 Region: 18-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000314
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Trave1|38891|fgenesh1_pm.9_#_189
Domain Number - Region: 175-227
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000171
Family Glutathione S-transferase (GST), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|38891|fgenesh1_pm.9_#_189
Sequence length 254
Sequence
MSTSGITLYDVRSTVPQPWAPNIWRIRFILNYKRLPHRTVWLDFPEVESTLRTIGAPPSA
QKSDGRPVYTLPVIVDTLRSRTTPVVLSNVNTIAEYLEATYPARSIFPEGSRAMQALFVH
YVQEIFARPLLPILVPLTHQRLPERSQAHFRCGAPAVAPGAHLGGVAAAQHDQAWLAVKE
QFNFLASVLDKNHSDRNGVVAMGQDITYADFALCAVLIWIEKVSPHDCWARIREWNGGRW
ARLYSQCREYMDVC
Download sequence
Identical sequences jgi|Trave1|38891|fgenesh1_pm.9_#_189 XP_008041022.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]