SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|41340|gm1.224_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|41340|gm1.224_g
Domain Number 1 Region: 116-242
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000154
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 4-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000937
Family Glutathione S-transferase (GST), N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|41340|gm1.224_g
Sequence length 260
Sequence
MTTTPQRIALYGSPHSPFVARVRLALEEAQADYHTVFFDLDERPQWFFDNVNSAGKVSIS
TPQFNLAPPRPELTACSRDQVPTIVYRSSPDAPPEKPTPESAKIAESLVLLEFVADLHPN
ANLLPRDPVLRAKARLFIRKLDEKFQSAFLALLFDKDGGAEVLELLVELQNELPPTGYVV
GDWSIADAAFVPMVAAVGIVAKTGRGYFRDVDGGKLTQELAAPRFERLREYMRINKERPS
FDEFVAIKWVKRFAKPADKK
Download sequence
Identical sequences XP_008032079.1.43472 jgi|Trave1|41340|gm1.224_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]