SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|41957|gm1.841_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|41957|gm1.841_g
Domain Number 1 Region: 35-296
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.8e-49
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 346-659
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.21e-38
Family Extended AAA-ATPase domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|41957|gm1.841_g
Sequence length 743
Sequence
MSGFDSDRVYSVAVHDVAEPTAPELPSQTEKLLLDFLLQYRVGGDFIYRDKLRANLLLKQ
HQVEVDLRHVGLYNDELAHVIQERPADILPLFESAASKAARTILFPLASNSDAAHESIPF
VQVLVRSGLNLQQFRELTADTMNKLVRIPGIVISASVLSSRATKLHLQCRACRSTKIIFP
PSGLGGLGGGSDRGLPRVCDAPELENQKKDCPLDPYLIIHSKSAFTDHQTLKLQEAPDMV
PVGELPRHMLLSADRYLTGQVVPGSRVIATGVYSTFQSAKNRTKGAAALRDPYLRVVHLE
VSSPAAGGGGGANPFGAQFTPEEEEEFGEMARSEGFYERFAKSVAPSIFGSLDIKKAITC
LLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLT
ASVQRDSVSREFYLEGGAMVLADTGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGIT
TVLNSRTSVLAAANPVWGRYDEGRSPGENIDFQTTILSRFDMIFIVKDEHNEQRDRMIAK
HVMNIHMNRPNQNADEHGEAVGEIDIDKMKRFIAYCKAKCAPRLSAEAQEMLSSHFVSLR
KQVQQVEQDNDERSSIPITIRQLEAIIRISESLAKLSLSPVVQNHHVEEAIRLFKFSTMD
AVSAGSADGLSRGAVNEEMTKIEKEIRRRLPIGWSTSYQSLVREFVTQQGYSSHALERTL
FVLEKREIIRFSGQKKVVHRVGV
Download sequence
Identical sequences jgi|Trave1|41957|gm1.841_g XP_008032163.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]