SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|43025|gm1.1909_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|43025|gm1.1909_g
Domain Number 1 Region: 112-250
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.07e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 28-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|43025|gm1.1909_g
Sequence length 258
Sequence
MSVDPSVLPRRHLCCTAYHRAQPSRAINEEKKQFTLYTHNAGPNGWKVVFALEEFGLTGE
QKSAEHLALNPNGRIPTLVDHHNGDFVVWESNAILLYLVNCYDPKHKISVVDEKDRYTLL
QWLFFQASGQGCVCLHSCGNENRCVHCLDNAYFGQANWFPKYHSEKLPSAIERYQKEAQR
VFAVLASVLSKQEWLVGGKPAIADLSFITWNRGAFHVILKEADVNPEKDFPAVWRWSKAL
EARPAVAKVLQIQASKPG
Download sequence
Identical sequences XP_008033753.1.43472 jgi|Trave1|43025|gm1.1909_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]