SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|46706|gm1.5590_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Trave1|46706|gm1.5590_g
Domain Number - Region: 27-66
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00511
Family Glutathione S-transferase (GST), N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|46706|gm1.5590_g
Sequence length 228
Sequence
MSLPAFQARSDMLTVPSRILLKLGSTRVHSCRSDFVKDAPPRHIPCMEDDAGFQLHEGAA
VLRILTNGIARICIDVFNRSPQLPPPNTASPAMRSGSLTEPLSRHRDRANGPSHWTHLSQ
AARLPENPAAARWPRQSPSAMRNPPTPARVPQCVQHPSPGRSRWVRIPIALRCANMTPPS
SAVPSSHRIPSPVDGVYVAWRAGGPDDPVYLVYITLSLYWSLLCPRFT
Download sequence
Identical sequences XP_008037391.1.43472 jgi|Trave1|46706|gm1.5590_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]