SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|46833|gm1.5717_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|46833|gm1.5717_g
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000039
Family Glutathione S-transferase (GST), C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|46833|gm1.5717_g
Sequence length 107
Sequence
MSHPENLPSVIERYQKEMLRILGVLESVLSKQEWLVGGRCTVADLSFIVWNALILDGTIT
KTYTPAQFEEDFPAVFRGFRIGSRWHQAMMNRQTVKKIYAIREAFKV
Download sequence
Identical sequences jgi|Trave1|46833|gm1.5717_g XP_008037414.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]