SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|46834|gm1.5718_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|46834|gm1.5718_g
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.17e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|46834|gm1.5718_g
Sequence length 128
Sequence
MSQEHHFTLYTHNFGPNGWKVAIVLEELGLEYRSLYLDVKKGEHKAPEHTKFNPNGRIPT
LIDHKNNDFVVWESDAIITYLVEKYDLEGKISATSFEEKMQQLQWLFFQASGQGCVISSV
LPSAGTVA
Download sequence
Identical sequences jgi|Trave1|46834|gm1.5718_g XP_008037415.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]