SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|48599|gm1.7483_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|48599|gm1.7483_g
Domain Number 1 Region: 6-50
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000269
Family Glutathione peroxidase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|48599|gm1.7483_g
Sequence length 50
Sequence
MSDAKSFYELSASLPGGKTYKFEELKGKVVLIVNVASKCGFTPQYKGLQA
Download sequence
Identical sequences jgi|Trave1|48599|gm1.7483_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]