SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|54358|gm1.13242_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|54358|gm1.13242_g
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.11e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.009
Further Details:      
 
Domain Number 2 Region: 93-226
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000355
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|54358|gm1.13242_g
Sequence length 241
Sequence
MVQPGQITFYTHVYSPYCHRVHIALEEAKAEYTPCSVNLMDRPPWYNTKVNPAGKIPAIT
YGGPKHAPEDPSPEAAKINESTVILEFLADIFPEAKLLPADPVQRAQARLVIATWEAKGF
EGFKDFFFMYAQATSPEKTLLDGLDAFQARLPATGFAVGEWSNADSAVAPFLLRAELLLK
NDLGTYPVGEGKKVYEVLQGPRFARLRKYLEDVKEHPTIKTTWDEALQFGIWSQNPMFKR
A
Download sequence
Identical sequences R7S6M8
XP_008045480.1.43472 jgi|Trave1|54358|gm1.13242_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]