SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|60138|estExt_fgenesh1_pm.C_9_t10451 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|60138|estExt_fgenesh1_pm.C_9_t10451
Domain Number 1 Region: 18-133
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.63e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 104-236
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000348
Family Glutathione S-transferase (GST), C-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|60138|estExt_fgenesh1_pm.C_9_t10451
Sequence length 257
Sequence
MPSLTTPTPSTAKPQHKQLTFYTSPYSPYCHRVHIALEEAKVAPSLVEIDLRPGCKPAWF
TSRVNPMGTVPAFTYGGAPAPPDQPSPAALKLAESIVLIEFIADLHPEAALHPKDPELLA
RARLFITLSHDTLHHAFRGFFFRGERIESILPSLEAFQALLAPSGYAVGPWSMADVVVAP
MIVRFMRLAGYEIGKYPMGEGKRLLKALGEPKFARFMQYYQSLWERPSVKTTWDEHTNVK
MWRIHPNVNRSTSAVGH
Download sequence
Identical sequences jgi|Trave1|60138|estExt_fgenesh1_pm.C_9_t10451 XP_008041631.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]