SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|62662|estExt_fgenesh1_pg.C_2_t10265 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|62662|estExt_fgenesh1_pg.C_2_t10265
Domain Number 1 Region: 279-605
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000328
Further Details:      
 
Domain Number 2 Region: 122-250
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.3e-22
Family Anticodon-binding domain 0.00072
Further Details:      
 
Weak hits

Sequence:  jgi|Trave1|62662|estExt_fgenesh1_pg.C_2_t10265
Domain Number - Region: 762-903
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000101
Family N-acetyl transferase, NAT 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|62662|estExt_fgenesh1_pg.C_2_t10265
Sequence length 964
Sequence
MASSLKKVLSKVVSHTRSSSKASSKDSLNGGAHPVTNGKIEKTAKPSVEIDDTNAKGETA
ARKQQAKDAANGLPRPSTNSERPLSFTEQKEDRKAEREAKDDEEAKARKERMQKLHEEDP
LRDNWGDLPLNMSQIRVERKYNQLRDIPNMKEGDQGIFRARIHHIRALGSKIVFLIFRHQ
FTTVQGVLTEEADKVSQTMVRWAEGVSRESIVLVEGVIQRPPPDQEDVHGTTIHQYEIKI
AKLHVVSAPSTTLPYQVEDVSRPKEYYEREDAQFVRVGERTRLDHRVLDLRSPASHAIFR
IHAGVCELFRSYLTERHFTEIHSSKLQGSSTESGAAVFKVDYFRRPAYLAQSPQLAKQMC
IAADMDRVFEIGPVFRAENSNTHRHLTEFTGLDLEMAIDSHYHEVVDLLDDLFKAIFKGL
QSKFRDEIETVKQYYPSDDVVILDKTPRLRFSEGIQMLKDSGWKEDDGSELSETDDLSTR
AEQRLGQLVKEKYGADFYIIDKFPLEVRPFYTMPDPEDNRWSNSYDFFLRGEEILSGGQR
IHVAPLLEERMREDGVDPESMQEYVDGFRWGCPPHGGGGVGLERIVMLFLKLGNIRWASL
FPRDPRSFIVRGQDPTEAALVAANSLILHGPESTTIQPGKRSGDLPPLENLIAKYGDATN
TSWTDPAWTVWRDKATGAAVGYIPENGFAVTFGNPLCSADQIPRVVKAYLAHLHEQNLKP
IWGCVDRSTEQYLAEDLGWGAVIAVAEERINPTEVDPAESDKTVRRKIHRAEREGVKIVE
VGPEMDPQVKKQLEERCQEWAANRKGTQIHLTGVRPFDDMAHRKYFYATDKDGKPCAMVV
LAQLAPKHGFQIKWALEFPGAPLGAIEYILTYVIKKLGDAGVKSATFGAGAIDKFHPAEN
VRGFRVKALEKAYNGLSSTFNLTNKGDFRSKFGTWQDPMYICYPKGGLGMKGIDAIMTML
QKEK
Download sequence
Identical sequences jgi|Trave1|62662|estExt_fgenesh1_pg.C_2_t10265 XP_008034149.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]