SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|64949|estExt_fgenesh1_pg.C_6_t10344 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|64949|estExt_fgenesh1_pg.C_6_t10344
Domain Number 1 Region: 227-479
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.36e-46
Family ATP-dependent DNA ligase catalytic domain 0.00085
Further Details:      
 
Domain Number 2 Region: 499-635
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.08e-21
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0034
Further Details:      
 
Domain Number 3 Region: 916-1025
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000174
Family DNA topoisomerase II binding protein 1, TopBP1 0.07
Further Details:      
 
Domain Number 4 Region: 40-250
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.00000000034
Family ATP-dependent DNA ligase DNA-binding domain 0.022
Further Details:      
 
Domain Number 5 Region: 683-772
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000465
Family DNA-repair protein XRCC1 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|64949|estExt_fgenesh1_pg.C_6_t10344
Sequence length 1027
Sequence
MQPTPAPSSPPASQLQVPASQLLPPAVAAEDHPIEYPAPPQNKGSAPFQVLVALFEKLQN
ERKPEKRRRLIASWFNGWRKDIGYDLFPVLRLILPQKDRERTVYGLKEKNLAKAYIKLIP
LDRHGPDAIRLLNWKKPTERYRSAGDFPSVLWEVVNKRNNVTEGSLTIDDINGVLDELAQ
NMGKSDLQSKILQRVYNRATSDEQRWLVRIILKDMIISVKENTVFGVFHPDAHDLFNTCS
DLKKVTWELWDPERRLNDEDKAVQLFRAFAPMLCKRPTKKIEDSVKEMQGRAFIIEEKLD
GERIQLHKRGNEYFYCSRKGKDYTYLYGKHVGTGSLTPYIDSAFDPRIDEIILDGEMLVW
DPVSERNLPFGTLKTAAIDRSKKEFNPRPCFKVFDLLYLNGTSLLHKSLKFRKRNLRSCV
IPVAGRIELVTEFEGRTAKDVRTRMDDIIGNRGEGLVMKHPDSEYVLNGRNKDWIKVKPE
YMDNMGETVDVLVVVLTFIAAGNYGSGRRSGGVSTLICAVLDDRRVHNDDDEPKYSTFVR
IGSGLSYADYIWIRQKPWKPWGRDAPSYLQVARKGHDDKGDVYLEPQDSFIVKVKAAEIT
STDMYHLGFTMRFPRALQIRDDLSIADCMTASAVLEGIRSEKKRKMEDDTDKPKKKQNRT
AKKPTMMPEYRGVNLKDVEVEDNLFGDFKFVVSSDPKSRTGADDKKALLQMIHAHGGKYA
QVARNDPNILIVYGGQTTPYDLRLIMDKGVCDIIRPQWILDCVAYEKIVPLTKKYFFHAT
AARKETDEYAEDDSDTEEEPEDEPPSPSPSASRKSKSPPQEEPSQPKEEIKIDPSMAEWF
DVGASLQQSGGSKGGYISGSDTEEDPESDNEDVDPEAASEDEDWEKVDQDSGKSQEESKG
KASEARMGEDDNAMAYDEERIFKHLCLYLDSPSNARKHGMKVDTKREADIEKRFSEMSNV
ITENGGRVVDLDDPKLTHVILDKRDISRRKVLIARTSEPKRRHLVISDWVDACVAEETLL
DEEEFNP
Download sequence
Identical sequences XP_008038813.1.43472 jgi|Trave1|64949|estExt_fgenesh1_pg.C_6_t10344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]