SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|73687|estExt_Genemark1.C_9_t20099 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|73687|estExt_Genemark1.C_9_t20099
Domain Number 1 Region: 32-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.42e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 129-265
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.17e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|73687|estExt_Genemark1.C_9_t20099
Sequence length 286
Sequence
MSNDRDTGRPYHLACTGEALATVQAHISPEHITLFGSCFCPFVQRVWVTLEHLGIDYAFR
QYYEVDPYKKPAELLELSPKGLVPALRLNNFDSPRALNESTIIIDFLEELATSDTRRSSH
TTESLFPAPSDPYARALIRLQADSVNRSLIPAFYRYLQAQDEAKQVEGAKGFVEALESLV
TLFRRAEREGYTQYGLWHECGSLSYADVMAAPWLFRATNVLKHYRGFVLPEGEQFRAYVG
RMLGHPAVKRTCSTEQLYLDSYERYAFNRPNTSQVANAINAGTALP
Download sequence
Identical sequences XP_008041555.1.43472 jgi|Trave1|73687|estExt_Genemark1.C_9_t20099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]