SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|73974|estExt_Genemark1.C_10_t10340 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|73974|estExt_Genemark1.C_10_t10340
Domain Number 1 Region: 121-264
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.13e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.75e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|73974|estExt_Genemark1.C_10_t10340
Sequence length 279
Sequence
MSAPKKQRTDEYVLYYWPGIPGRGEYVRLALEYAGIPYTERSSDLMSTLASPAKVGTPPH
FAPPALQLPSGRVLSQTGNILNHIAPRCGLAGVHGNALDTHGEAAREAFRALDADALEKA
EEERAVVHQLTLTALDVQNETHDVHHPVATSLYYEDQRAEAARAAKVFREVRIPRFFEYF
ESVLATNPATAESKAGRTFLVGAQTTTADLVLFHVIDGLLFQFPKRLAKLKETKKYENLF
KLHERVQEEKGIKEYIASGKRQKFSLGIFRHYEELDGEE
Download sequence
Identical sequences XP_008042252.1.43472 jgi|Trave1|73974|estExt_Genemark1.C_10_t10340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]