SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|114024|e_gw1.2.1280.1 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|114024|e_gw1.2.1280.1
Domain Number 1 Region: 80-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.53e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 5-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|114024|e_gw1.2.1280.1
Sequence length 231
Sequence
MSSRKQFTLHGDVTGPNPLKVAVVLEELGLEYDIVNINVRTGEHKNPEYLKLNPNGRVPT
LVDHSNGDFTIWESDAILLYLVENYDKEHKLSVADVHEKFKLIQWLFFQASGQGPYFGQA
VWFMRYHHERLPSAIERYQKEILRVLGVLETVLSKQEWLVGGKLTVADISFITWNQMAIG
WGLEGVEGGDVQKEFPNVYKWHQKLVSRPIVRKFLDMQAETFRKFSESQAK
Download sequence
Identical sequences XP_008034402.1.43472 jgi|Trave1|114024|e_gw1.2.1280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]