SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|140756|estExt_Genewise1.C_1_t80451 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|140756|estExt_Genewise1.C_1_t80451
Domain Number 1 Region: 460-681
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.87e-55
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000403
Further Details:      
 
Domain Number 2 Region: 309-454
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 4.71e-32
Family Domain of poly(ADP-ribose) polymerase 0.00024
Further Details:      
 
Domain Number 3 Region: 154-277
Classification Level Classification E-value
Superfamily WGR domain-like 6.41e-28
Family WGR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|140756|estExt_Genewise1.C_1_t80451
Sequence length 682
Sequence
MPPRKKAAAKTDVDGAATPAATRASGRARAPSAKAAAVAAVAASAALPVDTRIKATGKPP
TKAAAKAKGKGKRAREESDDEEDAAAPAAGAADDEEEEEEEEVKKPKAKRARKDTAGVSV
DADADKKKPASKPASKPASKPAAKKTKDVADLPQKMVTVVKRGAAPVDGYSGFVISHEVL
VTPEGVWDAMLNQTDLGKNANKFYLLQLLHPIGNNASCILHTRWGRVGENGQSQQKGPWP
AATAVNEFKKQFKAKAGVSWEQRVGMVPAKGKYMWLERSYDDEETADAKNGSGKSGESSS
QDDEKIPDSTLSPEIQTLCRLIFNSSLIDAHLSSMNYDANKLPLGKLAKSTILNGFAALK
TLSEIIAQPNSNAAQALGGYRPAVETLTGRYYSIIPHVFGRDRPIVIDTIDRLKKELELV
DALGDMEIASKLISSTIPRDADGNAVNPLDGHFRSLQLSKMEPVARASPEFTALERYTRD
THGATHRHYGVDVLSAFRVEREDETAAWMKAGFDSVPDGERLLLWHGSRTTNFAGILKQG
LRIAPPEAPVTGYMFGKGVYFADVMSKSANYCHTHLSNNTGLLLLCEVAAKPFYEQHEAN
YNADADCKAAGARATKGLGRSQPGDWQDAGAALNHPELRGCHMPKGPAVDVQDPKGYLQY
NEYIVYNTSQIRLRYLLMVKMG
Download sequence
Identical sequences XP_008033384.1.43472 jgi|Trave1|140756|estExt_Genewise1.C_1_t80451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]