SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|175922|estExt_Genewise1Plus.C_160156 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|175922|estExt_Genewise1Plus.C_160156
Domain Number 1 Region: 222-289
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000174
Family Glutathione S-transferase (GST), C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|175922|estExt_Genewise1Plus.C_160156
Sequence length 305
Sequence
MASPFALSLPPPLRHFFSLFPLYTHPPIFSDDKARPVTSPTLWIHPPWSPDADVLSSDVE
CLKWQAYLALRGLSDVAIRWDVSADGALDNRLPNLHVPLKTLQGASDAVKEQEDGEGELL
PAHLIPEWVDGRVGALDELEGYVDEAARDESRAWVSLLEGNVHAALVLNQPSTTTLLSLL
SPYKTKPRSLEVVVAHPPAPLFGISSLLPSYGTHVNVEAIEQQYKEAIASLSERLGTDKW
FLGSSSPTALDALVFAYLHSILHSKEHTLRFEVTRRVNLVAWERRVQSQVRGAFRFLEAT
STLVQ
Download sequence
Identical sequences R7S742
XP_008045309.1.43472 jgi|Trave1|175922|estExt_Genewise1Plus.C_160156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]