SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|50990|gm1.9874_g from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|50990|gm1.9874_g
Domain Number 1 Region: 172-315
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.15e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 36-92,119-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000311
Family Glutathione S-transferase (GST), N-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|50990|gm1.9874_g
Sequence length 318
Sequence
MSSTRDVSHLTDITKRPLEPDGTFKRRPTSFRDFIQKGGKFEPEKGRYHLYVSYACPWAT
RALIVRKLKGLEDFIGVSVVSPQMGAKGWPFASADAYPGADLDPLYDVKHVSDLYLRAKP
DYDGRVPLLWDKKTATIMNNESSEIIRMFNSAFDDQLPADKAAVDLYPEALRKEIDEINE
WVYDTVNNGVYKSGFATSQTAYEAAVVPLFESLDRLEKILTEKDYLVGDRLTEADIRLFV
TIVRFDPVYVGHFKGNIRTIRDGYPAIHLWLRKLYWNNSAFSSTCDFDHIKTHYYWSHPS
INPHRIIPVGPIPNILPL
Download sequence
Identical sequences jgi|Trave1|50990|gm1.9874_g XP_008041952.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]