SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|64507|estExt_fgenesh1_pg.C_5_t10288 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|64507|estExt_fgenesh1_pg.C_5_t10288
Domain Number 1 Region: 228-363
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.28e-43
Family Myf domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 29-120
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.98e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|64507|estExt_fgenesh1_pg.C_5_t10288
Sequence length 400
Sequence
MSAAAALAKLPSPLRDLVAGAAQDGSEDFGKSEKDKAEVAEWIDKVAQGDVAKPESLKDL
EASLVPRTYLVSNYFTAADAALYGALHPVLSQLQPAQYYSQPAITRYFDHVQHRASIRKA
AEPLAPAFSIVAFNLENAPHQERKAEAPKKKEKAKAAPATEAETPAAPVKAEKAAAKAEK
KAKTEQGEKAAEQPQEGAKELKTQKKEKKVKEPKAAEKKPAEDAGEPSPSMIDLRVGHIV
DIKKHPDADGLYVEQIDFGEETGPRTVVSGLVNYIPIEDMRDKYLVGVCNLKPANMRGVK
SFAMVLCATHKDGKDAGIELVQPPAGSKVGERIFFEGFEGGEPLSQLNPKKKIFETVQPG
FTTLDTREAAWVDPATKSVHRIRTKDGVCVAPRFVGASLS
Download sequence
Identical sequences XP_008037818.1.43472 jgi|Trave1|64507|estExt_fgenesh1_pg.C_5_t10288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]