SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|73357|estExt_Genemark1.C_9_t10038 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|73357|estExt_Genemark1.C_9_t10038
Domain Number 1 Region: 9-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.05e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0066
Further Details:      
 
Domain Number 2 Region: 111-224
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000969
Family Glutathione S-transferase (GST), C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|73357|estExt_Genemark1.C_9_t10038
Sequence length 237
Sequence
MASPAAPTVPDATAPKLVVHHLNNSRSQRILWLLEELEVPYELKKYQRTAEMTAPPELKA
VNPLGTAPAITDDGLNLAESGAIVEYIIQKYGNGRAQPPASGKIDDLYFTHYSEASLMPM
LVNKLIFKIIPERSPFFIRPILSAVFNQVSAKMLDPRLKIHAEMIEKHLAKDDRQFFAGG
EEPTAADFMMIFCLEAWGTRGEIGEKTKAYVARIHARPAYQRGLEKGGEYAYAKPTA
Download sequence
Identical sequences XP_008041249.1.43472 jgi|Trave1|73357|estExt_Genemark1.C_9_t10038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]