SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Mellp1|78219|estExt_fgenesh1_pg.C_260086 from Melampsora laricis-populina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mellp1|78219|estExt_fgenesh1_pg.C_260086
Domain Number 1 Region: 19-141
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-17
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0025
Further Details:      
 
Domain Number 2 Region: 179-283
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000785
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Mellp1|78219|estExt_fgenesh1_pg.C_260086
Sequence length 498
Sequence
MPSSSFTANEKATIKKSLPTNYHKILAAGICRIYYAYPDPNHWSFTGLSGALTFGRSTSS
NQLNQFWFKLIDLEGTRGTIWEHEIYEDGSGHPGKGVFGYVQERTFWHSFQGDECMIAFV
FSNEDEASTIYKKVINRSKYASKSSSKSTPVETTSPQVSPVVNGKKKGGIDKSMIGAPSG
FRRVAHMGYDSKLGFTTENVDPSWAQLLTNLSSMGFSQDDISKNEDFIKEFVNSAGGVNQ
ILSNSNSSAPGRSNGPPIPPVSRVPPPSVTAPITSKRVKPPAPPAPRRNGNSTPDDTTSS
SIGAPTTTQTIPPPSRPPPSTHAPSRPAPPVIPSPAARSNAPPPPSSTSSVPAAPPPPPA
PPMSQSRAPPAPAPPAPPAPPAPSAAAPPPPPPPPAGAPPPPSMTSLTPVAGDRANLLAS
IQGKGIHVLKKTPQSNSDSTRNPLSQSTSSTTKPDTGGGEGGGGGDLAASLAAALNKRKG
TMGDDSDEEGGGSDDEWD
Download sequence
Identical sequences F4RRM7
jgi|Mellp1|78219|estExt_fgenesh1_pg.C_260086 XP_007411747.1.63152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]