SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384207643|ref|YP_005593363.1| from Brachyspira intermedia PWS/A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384207643|ref|YP_005593363.1|
Domain Number 1 Region: 30-138
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000235
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384207643|ref|YP_005593363.1|
Sequence length 276
Comment hypothetical protein Bint_0147 [Brachyspira intermedia PWS/A]
Sequence
MKYRLILLIILFISCTNRNNVSSENTLKRDEIEPNNSLEYSQYIDCNTVISGNIDDYNDV
DFYQINPTNGFVMDFSMSVYNLDANISMNIISTNNDTIFSINSEDISNYKGFIELKDILL
NDDAYYFKLNADKECKYNLKFIFNDDYIPANEAEPNNTIYEADTIHYPNEMVYGYFIKNY
FNIDEYMKPYIKKSGLIDVDFYQIKNDTDINTSINIKLEYSKDIDIILFDENYNYLKQGI
NQLNTSFEPNKKYYIALVCYGDKYIAERYILHYEFN
Download sequence
Identical sequences G0EPR9
gi|384207643|ref|YP_005593363.1| WP_014486636.1.89931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]